This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
./digester.pl -e t all_orf_pred_peptides.fasta > all_orf_pred_peptides_fixed_trypsin.fasta; | |
./digester.pl -e k all_orf_pred_peptides.fasta > all_orf_pred_peptides_fixed_lys_c.fasta; | |
./digester.pl -e r all_orf_pred_peptides.fasta > all_orf_pred_peptides_fixed_arg_c.fasta; | |
./digester.pl -e e all_orf_pred_peptides.fasta > all_orf_pred_peptides_fixed_glu_c.fasta; |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/usr/bin/perl -w | |
use strict; | |
use warnings; | |
my (@proteins, @peptides); | |
my ($protein, $i, $j); | |
@proteins = qw( | |
DAAAAATTLTTTAMTTTTTTCKMMFRPPPPPGGGGGGGGGGGG | |
ALTAMCMNVWEITYHKGSDVNRRASFAQPPPQPPPPLLAIKPASDASD | |
DAAAAATTLTTTAMTTTTTTCK |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/usr/bin/env perl | |
###################################################################################### | |
## enzyme_digestion.pl | |
####################################################################################### | |
use warnings; | |
use strict; | |
use diagnostics; | |
#Defining user options | |
use vars qw($opt_t $opt_l $opt_a $opt_v $opt_c $opt_h); |